PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.J00088.1.p
Common NameLOC105953144, MIMGU_mgv1a004369mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 532aa    MW: 59027.3 Da    PI: 6.9594
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.J00088.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.23e-32211268260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+ +Cp+kkkve++  d++++ei+Y+g+Hnh+k
  Migut.J00088.1.p 211 DDGYNWRKYGQKQVKGSENPRSYYKCTFLNCPTKKKVEQNL-DGHITEIVYKGSHNHPK 268
                       8****************************************.***************85 PP

2WRKY104.46.2e-33378436159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+ +d ++v++tYeg+Hnh+
  Migut.J00088.1.p 378 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFNGCPVRKHVERAGHDVRAVITTYEGKHNHD 436
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-27204269IPR003657WRKY domain
SuperFamilySSF1182902.22E-24205269IPR003657WRKY domain
PROSITE profilePS5081122.986205269IPR003657WRKY domain
SMARTSM007747.4E-35210268IPR003657WRKY domain
PfamPF031061.6E-24211267IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.8E-37363438IPR003657WRKY domain
SuperFamilySSF1182904.18E-29370438IPR003657WRKY domain
PROSITE profilePS5081137.883373438IPR003657WRKY domain
SMARTSM007742.4E-38378437IPR003657WRKY domain
PfamPF031062.0E-25379436IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MASSGGSSLN SYHTMSNFST SQYISSFTDL LTVNGKDQQD QDQEQEQERT SYFWEMNSEP  60
AVNKNKNTEQ IIIPKYKSFP PASLPLSPSP LSPSSYLSFP SNLTPSIFLD SPVLFSSSNV  120
LPSPTTGTFS ALFSKDEESR IPNFSFPSQT RPSDSSSSIF SSSVRINSTD SFDDSLNKQM  180
VVMKSEAAAS LPIQMHYPQQ PQYIRDQKKS DDGYNWRKYG QKQVKGSENP RSYYKCTFLN  240
CPTKKKVEQN LDGHITEIVY KGSHNHPKPQ STRRSSSSNN SIHNNSSSYN NGQSNNSFLE  300
NAQVDPTAEN NNNSSASFGD DDFEQGSSMS NSRDDDENEP QAKRWKGGDE NEGISASGSR  360
TVREPRIVVQ TTSDIDILDD GYRWRKYGQK VVKGNPNPRS YYKCTFNGCP VRKHVERAGH  420
DVRAVITTYE GKHNHDVPAA RGSGSYSMTR PPIMSTAIKP SVINGHISNG ANFVNQNGGQ  480
RMQNQTPYTL QMLQSHNNNN TDNFAFSGYG NSGGGAKEEP KDDSFFDSFL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-33211439878Probable WRKY transcription factor 4
2lex_A3e-33211439878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012832231.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-127WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A022RQF10.0A0A022RQF1_ERYGU; Uncharacterized protein
STRINGSolyc09g014990.2.11e-169(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-121WRKY DNA-binding protein 33